Bitcoin Mining Calculator CoinWarz

r/sportsbook: sports betting "discussion"

sports betting "discussion"
[link]

⟳ 870 apps added, 78 updated at f-droid.org

Notice: this update is spurious, and the issue is being looked at.
⟳ f-droid.org from Wed, 26 Feb 2020 20:21:50 GMT updated on Sun, 01 Mar 2020 05:23:29 GMT contains 2962 apps.
Added (870)
Updated (78)
2020-03-01T05:53:18Z
submitted by BrainstormBot to FDroidUpdates [link] [comments]

My installed apps; list mostly of Free and Libre Open Source Android Software

Free and Libre Open Source Software returns power to ordinary, everyday people.
Most of these are available on F-Droid. (Use G-Droid for a better UI and excellent ratings system!)
AdAway 4.2.2 (org.adaway) -- No better Android ad blocker. Root required.
Amaze 3.3.2 (com.amaze.filemanager)
APKExtractor Lite 2.8 (com.tutorialsface.apkextractorlite)
APKMirror 1.2 (taco.apkmirror)
AppOpsX 1.2.5 (com.zzzmode.appopsx) root required
Aria2Android 2.0.6 (com.gianlu.aria2android)
Aria2App 4.3.0-beta2 (com.gianlu.aria2app) -- Both search for and download torrents in one app!
Audio Recorder 3.2.20 (com.github.axet.audiorecorder)
Aurora Store 2.0.5-β (com.dragons.aurora)
BackgroundRestrictor 1.5.0 (com.pavelsikun.runinbackgroundpermissionsetter) root required
Bank Australia 3.6b7 (com.fusion.banking) -- Proprietary. Ethical bank, no Aussie bank has a better app.
Barcode Scanner 4.7.8 (com.google.zxing.client.android)
Bitcoin Wallet 6.35 (de.schildbach.wallet)
BitPay 4.6.2 (com.bitpay.wallet) -- I have this because I couldn't find any Free and Libre Open Source bitcoin cash wallets. Have you heard of any? Please let me know.
BlueWallet 3.7.2 (io.bluewallet.bluewallet)
Briar 1.1.5 (org.briarproject.briar.android)
BusyBox 1.29.2 (ru.meefik.busybox) root required
Calendar 6.3.0 (com.simplemobiletools.calendar.pro)
Call Recorder 3.0.2 (org.skvalex.cr) -- Proprietary. Meets my needs.
Chromium 74.0.3691.0 (org.chromium.chrome)
ClassyShark3xodus 1.0-5 (com.oF2pks.classyshark3xodus) -- Great for finding which apps have trackers and then blocking the trackers with AdAway.
Contacts 6.3.0 (com.simplemobiletools.contacts.pro)
Conversations 2.4.0+fcr (eu.siacs.conversations)
Copy to Clipboard 1.0 (se.johanhil.clipboard)
DAVx⁵ 2.2.3.1-ose (at.bitfire.davdroid)
Draw 4.3.1 (com.simplemobiletools.draw)
Dumbphone Assistant 0.5 (com.github.yeriomin.dumbphoneassistant)
F-Droid 1.6-alpha1 (org.fdroid.fdroid)
FairEmail 1.339 (eu.faircode.email)
FastHub-Libre 4.6.7 (com.fastaccess.github.libre)
Fedilab 1.75.0 (fr.gouv.etalab.mastodon)
Feeder 1.8.8 (com.nononsenseapps.feeder)
Feeel 1.94 (com.enjoyingfoss.feeel)
Fennec F-Droid 63.0.2 (org.mozilla.fennec_fdroid)
File Manager 6.1.2 (com.simplemobiletools.filemanager.pro)
Firefox Klar 6.1.1 (org.mozilla.klar)
FOSS Browser 6.2 (de.baumann.browser)
FreeOTP+ 1.0 (org.liberty.android.freeotpplus)
Frost 2.2.2 (com.pitchedapps.frost)
G-Droid 0.8.0 (org.gdroid.gdroid)
Gallery 6.5.2 (com.simplemobiletools.gallery.pro)
GPSTest 3.2.10 (com.android.gpstest.osmdroid)
Jitsi 0.1.258 (org.jitsi)
KDE Connect 1.10.1 (org.kde.kdeconnect_tp)
Kernel Adiutor 0.9.73.3-fdroid0 (com.nhellfire.kerneladiutor) root required
LibreTorrent 1.9.1 (org.proninyaroslav.libretorrent)
Magisk Manager 7.0.0 (com.topjohnwu.magisk) root required
Manyverse 0.1901.2-beta (se.manyver)
Markor 1.2.0 (net.gsantner.markor)
Messenger Lite 40.0.0.25.156 (com.facebook.mlite)
MuPDF mini 1.14.0 (com.artifex.mupdf.mini.app)
NewPipe 0.15.1 (org.schabi.newpipe)
Nextcloud dev 20190216 (com.nextcloud.android.beta)
Nova Launcher 6.0-beta4 (com.teslacoilsw.launcher) -- Proprietary. I tried a few free and libre open source launchers and thought none of them were as good.
Nova Launcher Prime 2017 (com.teslacoilsw.launcher.prime)
Om 1.0 (com.enjoyingfoss.om)
Open Camera 1.45.1 (net.sourceforge.opencamera)
Open Link With 2.5-floss (com.tasomaniac.openwith.floss)
OpenBeautyFacts 2.9.8 (openfoodfacts.github.scrachx.openbeauty)
OpenFoodFacts 2.9.8 (openfoodfacts.github.scrachx.openfood)
OpenKeychain 5.2 (org.sufficientlysecure.keychain)
OpenVegeMap 0.8.1 (pro.rudloff.openvegemap) -- Vegan!
Orbot 16.0.2-RC-1 (org.torproject.android)
OsmAnd~ 3.1.6 (net.osmand.plus)
Password Store 1.3.2 (com.zeapo.pwdstore)
Pedometer 1.0.5 (org.secuso.privacyfriendlyactivitytracker)
QKSMS 3.6.1 (com.moez.QKSMS)
RealCalc 2.3.1 (uk.co.nickfines.RealCalcPlus)
ReoTwé 2.06 (de.digisocken.reotwe)
SD Maid 4.11.7 (eu.thedarken.sdm) -- Proprietary. Works quite well. Root helpful.
SD Maid Pro 4.3.1 (eu.thedarken.sdm.unlocker)
Simple Keyboard 3.5 (rkr.simplekeyboard.inputmethod) -- There is no better keyboard. After per stops using predictive texting per's grammar, spelling, and language skills all increase.
Slide 6.0.1-3 (me.ccrama.redditslide)
Smart AudioBook Player 4.1.6 (ak.alizandro.smartaudiobookplayer)
Stargate Live Wallpaper 3.07 (com.MjolnirInteractive.SGWallpaper) -- Proprietary. Stargate is a fantastic TV show.
Suntimes 0.10.3 (com.forrestguice.suntimeswidget)
Suntimes Calendars 0.2.0 (com.forrestguice.suntimescalendars)
Telegram 5.3.1 (org.telegram.messenger)
Termux 0.66 (com.termux) root helpful
Tor Browser for Android (Alpha) 60.5.0 (org.torproject.torbrowser_alpha)
Transportr 2.0.5 (de.grobox.liberario)
Vinyl Music Player 0.19.2 (com.poupa.vinylmusicplayer)
WireGuard 0.0.20190215 (com.wireguard.android)
Yalp Store 0.45-legacy (com.github.yeriomin.yalpstore)
Do you have a list mostly of free and libre open source software? Please share your list of excellent apps!
ps. I pre-ordered a Librem 5. I wonder if I'll find it better than my Pixel 2.
Update: my server is offline because i'm not a smart person. Will fix it today. Fixed.
pss. Here's a TitaniumBackup update.zip (to be installed via recovery) with all of the free and libre open source apks.
https://cloud.chickee.net/s/5LYoMFHe5jLFPFj
It's hosted on my home server with very slow upload speed (100KB/s), so please download it only if you really want all the free and libre open source apps and can do other things while patiently downloading.
submitted by nmeal to Android [link] [comments]

IAMA 14 year old app developer. Introducing CryptoCalc 2, now with dogecoin prices!

Hey shibes!
tl:dr: CryptoCalc 2 is an uncomplicated, but powerful, dogecoin ticker and converter, with a simple and intuitive interface, smart alerts, and more. Check the free version right here, or take a look at the 99 cent version here, or update either version for free if you already have it. Note that the free version has ads.
I am a 14 year old app developer, and a huge CryptoCurrency enthusiast. Today, I am announcing the newest version of my app, CryptoCalc, with DOGECOIN SUPPORT!!!, smart price alerts, a new UI, more CryptoCurrencies, the same simplicity and ease of use as the original, and more.
I introduced CryptoCalc 1 a couple months ago, pitching it as a simple, but powerful app that you could use to check in on the bitcoin price and convert between fiat currency and bitcoin - free of the complexity and useless bells-and-whistles of other apps (After all, to just check on the bitcoin price, you shouldn’t have to swipe through hash rate, trade volume, and some meaningless graphs!). Many people liked it, but I also got some really great feedback, such as to incorporate dogecoin prices.
That is why, today, I am introducing CryptoCalc 2, which builds on so much of the great feedback I have received. Now, it is even better, with features like Dogecoin support and more.
CryptoCalc’s new UI is clean and gorgeous - we have updated the look of the program to be even easier to use. Like the original, it shows you just what you need to know - the exchange rate - while facilitating easy conversions and calculations.
Support for bitcoin, bits, litecoin, dogecoin, and peercoin makes the app even more versatile than ever.
Thanks to translations purchased with the tips you guys have sent (again, thanks!), the app natively supports Portuguese, Spanish, French, Dutch, Greek, Finnish, Italian, German, Russian, Danish, Traditional Chinese, Simplified Chinese, and Hebrew!
And that’s just some of the new features… so, please check out CryptoCalc 2! You can find the free version here, or take a look at the 99 cent version here. They are the same, except for the free version having ads, and the free version does not have Smart Alerts. Or, if you have already downloaded it, just update for free.
Much thanks - and as always, please feel free to give comments and feedback!
Oh, and a special easter egg just for you shibes - try loading the price while on airplane mode or not connected to the internet...
submitted by intergalacticrockets to dogecoin [link] [comments]

Introducing CryptoCalc

EDIT: free version now out! Search the App Store for "CryptoCalcLite"
I am a 13 year old bitcoin enthusiast and today, I am launching my app, CryptoCalc.
CryptoCalc is a new iPhone and iPod Touch app with a simple, intuitive UI that lets you see the exchange rate fast, and lets you calculate and convert effortlessly in 23 world currencies. Searching “Bitcoin” on the app store, it is inundated with cluttered, complex apps. If one is just trying to price their merchandise for the day, do they really need to know current network hash rate or amount of blocks mined in the last 24 hours or trade volume? Bitcoin apps are so feature rich, that they are not friendly for quick reference! Some may need all that information, and there are better apps for those... but for those of us that just want quick and simple tickers and conversions, there is now an option.
It is CryptoCalc. It offers a simple, clean UI that is perfect for just knowing what you need to know: bitcoin's exchange rate. Converting to bitcoin is easy: just tap the field, and enter the amount in fiat currency. $25 in bitcoin? It is BTC 0.06872, not BTC 0.06872 and 142 blocks mined in 24 hours and 90836 transactions in past day and here's an incomprehensible chart and the hash rate is... No jumping through hoops, no complexity: just simplicity.
The app can be found at https://itunes.apple.com/us/app/cryptocalc/id919003873?ls=1&mt=8 or by searching “CryptoCalc” in the iOS app store.
I would appreciate any ideas, comments, or feedback as I'm working on the future of CryptoCalc, as well as future Bitcoin apps.
Thanks!
submitted by intergalacticrockets to Bitcoin [link] [comments]

IAMA 14 Year Old App Developer. Introducing CryptoCalc 2.

tl;dr -- CryptoCalc 2 is an uncomplicated, but powerful, CryptoCurrency ticker and converter, with a simple and intuitive interface, smart alerts, and more. Check out the free version right here, or take a look at the 99 cent version here, or update either version for free if you already have it. They are the same, except for the free version having ads, and the free version does not have Smart Alerts.
Hello bitcoin! I am a 14 year old app developer, and a huge bitcoin enthusiast. Today, I am announcing the newest version of my app, CryptoCalc, with smart price alerts, a new UI, more CryptoCurrencies, the same simplicity and ease of use as the original, and more.
I introduced CryptoCalc 1 a couple months ago on this very subreddit!, pitching it as a simple, but powerful app that you could use to check in on the bitcoin price and convert between fiat currency and bitcoin - free of the complexity and useless bells-and-whistles of other apps (After all, to just check on the bitcoin price, you shouldn’t have to swipe through hash rate, trade volume, and some meaningless graphs!). Many people liked it, but I also got some really great feedback.
That is why, today, I am introducing CryptoCalc 2, which builds on so much of the great feedback I have received. One feature I personally like a lot is Smart Alerts: useful, unobtrusive alerts and briefings on the bitcoin price - at launch time, we offer two types of smart alerts: Morning Briefing springs to life when you first unlock your phone in the morning, unobtrusively briefing you on the bitcoin price right on your lock screen. The app icon also updates throughout the day to keep you updated on the bitcoin price - all without compromising battery life. We are working on server-side logic for more alerts, such as price swings - your download will help us justify further improving the already useful Smart Alerts.
CryptoCalc’s new UI is clean and gorgeous - we have updated the look of the program to be even easier to use. Like the original, it shows you just what you need to know - the exchange rate - while facilitating easy conversions and calculations.
Support for bitcoin, but now bits, litecoin, dogecoin, and peercoin makes the app more versatile than ever.
Thanks to translations purchased with the tips you guys have sent (again, thanks!), the app natively supports Portuguese, Spanish, French, Dutch, Greek, Finnish, Italian, German, Russian, Danish, Traditional Chinese, Simplified Chinese, and Hebrew!
And that’s just some of the new features… so, please check out CryptoCalc 2! You can find the free version here, or take a look at the 99 cent version here. They are the same, except for the free version having ads, and the free version does not have Smart Alerts. Or, if you have already downloaded it, just update for free.
Thanks - and as always, please feel free to give comments and feedback!
submitted by intergalacticrockets to Bitcoin [link] [comments]

IAMA 14 year Old App developer. Introducing CryptoCalc 2, with litecoin prices and more.

Hey litecoiners!
tl:dr: CryptoCalc 2 is an uncomplicated, but powerful, litecoin ticker and converter, with a simple and intuitive interface, smart alerts, and more. Check the free version right here, or take a look at the 99 cent version here, or update either version for free if you already have it. Note that the free version has ads.
Hello litecoiners! I am a 14 year old app developer, and a huge CryptoCurrency enthusiast. Today, I am announcing the newest version of my app, CryptoCalc, with LITECOIN SUPPORT!!!, smart price alerts, a new UI, more CryptoCurrencies, the same simplicity and ease of use as the original, and more.
I introduced CryptoCalc 1 a couple months ago, pitching it as a simple, but powerful app that you could use to check in on the bitcoin price and convert between fiat currency and bitcoin - free of the complexity and useless bells-and-whistles of other apps (After all, to just check on the bitcoin price, you shouldn’t have to swipe through hash rate, trade volume, and some meaningless graphs!). Many people liked it, but I also got some really great feedback, such as to incorporate litecoin prices.
That is why, today, I am introducing CryptoCalc 2, which builds on so much of the great feedback I have received. Now, it is even better, with features like litecoin support and more.
CryptoCalc’s new UI is clean and gorgeous - we have updated the look of the program to be even easier to use. Like the original, it shows you just what you need to know - the exchange rate - while facilitating easy conversions and calculations.
Support for bitcoin, bits, litecoin, dogecoin, and peercoin makes the app even more versatile than ever.
Thanks to translations purchased with the tips you guys have sent (again, thanks!), the app natively supports Portuguese, Spanish, French, Dutch, Greek, Finnish, Italian, German, Russian, Danish, Traditional Chinese, Simplified Chinese, and Hebrew!
And that’s just some of the new features… so, please check out CryptoCalc 2! You can find the free version here, or take a look at the 99 cent version here. They are the same, except for the free version having ads, and the free version does not have Smart Alerts. Or, if you have already downloaded it, just update for free.
Thanks - and as always, please feel free to give comments and feedback!
submitted by intergalacticrockets to litecoin [link] [comments]

CryptoCalc and MazaCoin?

Hi Mazacoiners,
I am a 14 year old app developer, and developer of the CryptoCurrency app CryptoCalc. As I am developing a version 2, I was considering adding mazacoin tickers and conversions to the app.
So, just curious - do you think that adding mazacoin capabilities to my app would be something the community would appreciate? Or is there no need for this kind of app?
submitted by intergalacticrockets to mazacoin [link] [comments]

Blockchain to fix horribly broken e-mail system like it is today?

E-mail as it is, is horribly broken. Horrendously broken.
It wasn't that many years ago that you could be assured your e-mail reaches whoever you were mailing to. Today it is a mere suggestion, that perhaps this should be delivered to this person, at least for any automated e-mail. This seems to be creeping to manual, organic email as well. Hell, we are seeing even internal e-mails being flagged by spamassassin as spam, organic, human written conversations! In that instance, the spamassassin is also maintained by one of the largest hosting providers in the world...
Hotmail/MS services has been for years (atleast about 4 years now!) been silently dropping email, not all, but some. There's a bit of relief lately, as they have started to favor a bit more marking as spam, rather than silently dropping.
I know, most email users don't see this problem, but those who use email a lot to do their work, and those who need to send automated emails (say, welcome e-mails for a service) this is a big problem. (Disclaimer, for us, our niche of hosting probably causes flagging as well. Our site is blocked by many corporate firewalls for example)
Blockchain to the rescue?
This is an idea i've been toying around with a few years. What if any single e-mail would cost a faction of a cent, and who receives the e-mail, gets paid for it? Now that would solve a lot of problems. I realize there has been some half assed attempts on blockchain based e-mail, but they are about replacing email (never going to happen). Using blockchain to enhance the current experience, with least minimal friction should be the goal, not re-inventing the wheel.
Imagine a say 0.01 cent (0.0001 USD) cost per e-mail. This price would not be cost prohibitive even for free e-mail service providers (Ad revenue etc. should exceed this value), never mind any legit e-mail users. Especially considering you get paid for receiving. So all legit e-mail services would work rather well regardless of the cost. (never mind free email service could profit from this)
Spam however? To send 1 million emails you would need to pay 100$. How many spammers would continue doing so? At least it makes things much harder, not so easy to use a botnet to send your email when you need to include your private key(s) to the botnet, or make some kind of private key management system, makes more complicated.
Small business newsletters? Say you need to send 100k e-mails to legit customers, 10$ is nothing. To human time crafting that newsletter is order (possibly orders) of magnitude greater than that.
Price would also fluctuate as per the market. The most difficult thing would probably be setting the self balancing mechanisms to keep per mail cost sensible. As such, the biggest hurdle in this might not be technical at all.
Technically, how could this work?
Sender sends a TX for e-mail they are sending for recipient. This TX contains message with mail ID, and a segment which can be used with the email contents to unlock the private key for the payment. This way it is verified that recipient mail servers receives and reads the email. Once the recipient server has calculated the private key, they can either TX the received sum to their wallet, or this needs to be formatted so that once the sender has sent it, they cannot recover the private key and double spend (technical hurdle A. For someone who knows their stuff unlikely to be an major hurdle)
Step by step repeat: * Sender checks if recipient has "MailCoin" capability * Sender sends TX to recipient * Sender sends the email to recipient * Recipient notices on mail header (say x-mailcoin-tx: TXID_HERE) that this is a "mailcoin" mail * Recipient checks TX if it has been received * Recipient puts the mail on delivery queue, antispam is instructed of heavy negative score (MTA admin configurable) * Recipient claims the value of the TX (this is the hurdle A). Recipient can only claim the TX value in case they have received the full e-mail. (Question, can this step be pushed even further down the delivery chain, but still remain MTA only level without mail client support?). Most likely solution is that the header contains the encrypted private key, and chain TX contains the key to decrypt that private key to claim the coins, or vice-versa?
Once recipient has the email & payment, they simply mark on their Antispam a automatic lower score and deliver it normally.
E-mail server side we have several components:
Most typical scenario would be the Recipient server works as outgoing as well, with single wallet. So depending on your mail volume, do you send or receive more on that wallet you might never need to worry about the coins (except for value going skyhigh and having like 10k $ worth of "MailCoins").
So perhaps additional components on per use case are needed, or more likely rudimentary scripting capability (ie. "MailCoin" daemon api) to keep the balances in check.
Technical hurdle B: This needs to be super super simple to setup. Or sufficient financial incentive. One would need to develop standard components & configs for exim, postfix, and other MTAs. Infact, make it autogenerate wallet ID etc. and easy to replace or import private keys etc. to put in coins for sending if you need to.
Privacy: On the blockchain you would not see the e-mail contents, only that e-mail likely took place (TX with mail UUID) to recipient. If sender can be deciphered it depends on them if it can be traced who they were. Automatic mixers? :) Recipient can also keep cycling the receive addresses to keep things private if they want to.
The biggest problem i see here, is that if an attacker can deduce the sender and/or recipient, it might to lead to some issues out of the scope of technical solutions. If attacker could read the emails, they would already have accomplished MitM and could just grab all e-mails.
Default implementation should be so, that from recipient address outsider cannot deduce the recipient server nor hostname.
Also, if attacker gains access to your mail with full headers, they could see the TXs in blockchain. MTA might need to scrub mailcoin related headers (yuck, scrubbing headers ....) for paranoid users, but most likely solution is that recipient retransmits those mailcoins as soon as they got the private key for the balance.
Blockchain: Blocks needs to be done every 10seconds or so, it needs to be fast. Preferrably even every 5 seconds, as not to cause any undue delay. Then again, if your application is reliant on receiving email within seconds, one should consider another means for communicating. Imho, email should be considered a little bit like snail mail, but on internet pace: Couple minutes delay is just OK.
Block size given the e-mail volume needs to be fairly large as well, considering the time between blocks. This is technical hurdle C: Hosting the full blockchain. I can easily foresee that this would grow to be terabytes in size. However, any large email operator would have vested interest in ensuring smooth operation of the blockchain, and for them, running a full node would have neglible cost.
(Technical hurdle C) Single email sent using the system could easily have TX contents of 100 bytes + TX headers + block headers etc. Say 100 bytes, and 100 million emails per day: 9.31GiB per day, 3 399GiB per year, 5 years later: 16.60 TiB just for the mail TXs.
Some estimate there is 200+ billion emails per day, but we all know large portion of this is spam. But even at 50 billion emails a day, 100 bytes per mail TX would add to 4.55TiB per day! So optimizing the blockchain size is obviously going to be important. The volume will be obviously much smaller as semi-spam (those daily half opt-in spamvertising from companies you know) will be lower as well. So probs 100+ billion emails per day at 100% adoption.
Blockchain should then be compressed, the whole block. Algorithm probably should favor speed over compression rate, and should be task specifically optimized (needs a simple reference release, where you can just stream the block contents into it and get output as compressed or uncompressed). The more compression there is, the more full nodes will be hosted by smaller operators :)
For large e-mail server clusters there should be central store for the blockchain, but this can be accessed on the system administratoconfig level already. The MTA components will just remotely talk to single full node daemon (so not really different from many implementations in existence right now), instead of each one running locally a full node.
At today's cheapest hosting rates 16.60TiB is roughly around 85-100€ a month. Purchase cost per 8TB drive is around 230€ mark right now, externals are cheaper. Not an issue for any even semi serious mail provider. Not even issue for datahoarder individuals.
However at 100 billion mails per day: 9.09TiB per day added, which is prohibitively large! We should be targeting something like 20bytes per mail final storage spent, or even less.
If it looks like it is going to grow really large, full node needs to have configurable multiple storages, so they can store parts of the blockchain on multiple different devices (ie. individual might choose to have it on 4 different external drives).
Filesystem side optimizations are needed as well, but these are fairly simple, just split into multiple subdirectories by the 10 thousand blocks or so, ie. 1 for blocks 1-10k, 2 for blocks 10 001 to 20k etc. Filesystems get exponentially slower the more files there is per directory. 10k might start to show slowing down, but is not significant yet.
Nodes could also implement secondary compression (compress multiple blocks together), if the blockchain starts to become stupid large. If it starts to become impossible to maintain, we could possibly implement a scrubbing methodology, where very old blocks get the TX contents wiped as they are not necessary anymore. Should not be an issue
Blocks with 10second target generated per annum: 3 153 600 Mails per 10second: 115 740 e-mails per 10second block. Final compressed size (say 20 bytes per mail): 2.20MiB + headers etc. per block Let's start small and allow linear growth to this, say 0.1% per day (36.5% annual) and start from 20k / 512KiB. After 3 years: 41.9k / 1072.64KiB per block, After 10 years: 93k / 2380.8KiB. (2027 we should have HDDs in the size of 30TB and daily max size for chain growth is 19.61TiB)
On the positive side every problem is an opportunity in disguise. If the blockchain is large, once again botnets will have a hard hard time to spamming, they can't host the full blockchain on infected machines. They will need to develop centralized mechanisms on this regard as well. One method i can see is by having TOR client built in, and via .onion domain to anonymize, but this is two way street, security researchers could exploit this (see above about the private keys) as well. Even without botnets, spammers will need to dedicate significant resources to host the full blockchain.
On the flip side, if spammer has also mining operation on the same local area network, they have both the income for mailcoins + full blockchain, and could leverage economies of scale, but this too would increase cost. And after all: This is all about increasing cost for spamming, while having the price in vicinity where real e-mail users, real businesses it is not a significant impact, or may even be an income source
Client side
Zero, Nada changes. No changes to outlook, thunderbird etc. Everything works under the hood at the MTA level. Very easy adoption for the end user. Everything is in the backend, server side.
Economics for users
Cost of operation has above been shown to increase wildly for spammers. But how about normal use cases?
Joe Average: They receive e-mail a lot more than they send, all kinds of order confirmations, invoices, newsletters and other automated e-mail. They will actually earn (however tiny amounts) from using this system. So for the masses, this is a good thing, they will see the earning potentials! which brings us to ....
New business opportunities! I could foresee a business setting up spam traps, the more e-mail you receive the more you earn! So it pays to get your receiver into spam lists. You don't ever need to read these, just confirm receive of them. All of sudden we could see even greater numbers of invalid e-mail addresses in spam lists, making spamming ever more expensive!
Free email services might proof to be extremely profitable, to the point of potential revenue sharing with Joe Averages (and above spamtraps). Because free email is mostly joe averages, they will have greater influx than outgoing. On the caveat, free email needs to have limits, but due to the low cost and potential of earnings, they could implement "mail credits" system, base is like 20 emails a day, but each received email could increase this credit limit. As such, it makes actually sense for free email services to implement this at the very least on the receiving side.
Business mass emailings. A business which has 100k valid e-mails on their database will not have a problem with paying few dozen bucks to have their mass mailing delivered. BUT they will make extra sure the content is good and targeted, something the recipient wants to receive. These will be the biggest spenders on email, apart from spammers.
ISPs, hell they get paid to provide e-mail. And they are on the same spot as free email service providers, they stand to earn more than spend!
Blockchain economics
This is where things might get interesting, there is so much potential.
However, there are several things definitively should not be done:
1 & 2 are easy, just do not mine outside of testnet prior to launch. (If devs get paid by companies, there is conflict of interest as well, but let's not get into that right now)
3: Miners and/or full node maintainers decide what goes on. Probably miners like bitcoin is supposed to.
4: Infinite & preferential supply: No after the launch "contracts" etc. to give coins to preferential parties, it should remain as on the launch unless majority consensus says there will be a change. Proof of stake is gray area imho, but then again also proof of work is the rich gets richer.
Mining: Storage requirement is a blessing in disguise, the massive storages required for this to function means that there will be no central hardware developer who sells all the shovels, without significant other markets. Ie. WD, Seagate, Toshiba the main players.
This means algo needs to be based on the full blockchain being hosted. The hashing needs to be so that GPUs are the king most likely, since almost anything good for CPUs is also doable in GPUs. Eventually someone will likely come with ASIC alternative, but due to masses of data it WILL require high bandwidth, high memory. Nothing like bitcoin currently, where low bandwidth, no memory requirement for the ASIC. There needs to be some expensive commodity components in there (RAM, Storage), and as such GPUs are the most likely candidate, and the bottleneck will not likely be computation, but I/O bandwidth.
Quickly thinking, previous block could include number of blocks to be included on the next for verification, in a highly compressible format. Let's say difficulty is number of blocks to be hashed, or from difficulty you can calculate number of blocks to be included. Previous blocks miner just chooses on random blocks to be included on the next one. Listing 10 series of blocks to be included, which can include series instructions. It could request block #5729375+100, or #357492+500 stepping 5 (every 5th block). Hell the random generator could use last block as seed for the next one to make it deterministic YET random as the emails and TXs change. (WTF, Did i just solve how the algo needs to work?!?) Only blocks which would differentiate is the first few, and obviously Genesis, for which an "empty" block would be what is to be hashed.
Hashing algo could be SHA256 because of the high requirement of streaming data, and most ASIC miners lacking in bandwidth (infact, it could be made compatible with bitcoin, but only those ASICS with higher I/O bandwidth than storage/ram I/O bandwidth is could actually boost the perf)
Different hashable list operations could be (on the block list what to be hashed on the next one): * Single block * Block # + number of blocks * Block # + (number of blocks with stepping) * Block # + number of blocks chosen by random using each hashed block as the seed for choosing next one (makes prefetch, preread, caching not work efficiently) * Number of previous blocks mined (ie. 50 last blocks) * Above but with stepping operator * Above but with choose random next X blocks, with variations based on the last hashed, sum of the hashed * All random pickers would have operation modes for the seed to be used: From hashed sum, the whole block, block contents, block header
These modes would ensure the blocks are there and makes it a lot dependable on variable factors, RAM speed, I/O seek time, I/O bandwidth.
This way we have proof that the miner has access to those blocks in efficient manner and the full blockchain is stored there, even if it is not practically retrievable from him / her over the internet for others to obtain a copy. HOWEVER, due to the data volumes, i think it is given they have fast access, but a miner would probably prefer not to share their blockchain contents to have bandwidth free for their mining, as the deadlines are tight. It could be built into the full node spec that they do not accept new blocks from sources which are not ready to supply any given block, and perhaps even periodic test of this. However, this would be unenforceable if people start running custom coded nodes which disables this, as it is not part of the blockchain calculation. It is not miner's benefit to "waste" precious bandwidth to serve others the vast blockchain, meanwhile it is end users benefit those running full nodes without mining to get them fast. So an equilibrium might be reached, if miners start loosing out because other miners will not share their blocks, they will start offering them, even if prioritized.
At 2MiB blocks, 10 second deadline, a miner would preferentially want the new block within 500ms, which would be barely sufficient time for a round trip across the globe. 500ms for 2MiB is 4MiB/s transfer rate inbound, and when block found you want it out even faster, say 250ms you'll need 8MiB/s burst which very very few have at a home. At more usual 1MiB/s it would take 2secs to submit your new block. On the other hand, if you found the block, you'd have immediate access to begin calcing the next one.
Block verification needs to be fast, and as such the above difficulty setting alone is not sufficient, there needs to be nonce. Just picking the right block is not guarantee there will be match, so traditional !???? nonce needs to be set as well most likely. As such, a lot of maths needs to be done to ensure this algorithm does not have dead ends, yet ensures certain blocks needs to be read as full and stored fully by the miners, just plain hashes of the blocks is not sufficient.
Perhaps it should be block data + nonce, then all the blocks hashes (with nonce, or pre-chosen salt) and to be generated block combined hash with nonce needs to have certain number of zeroes. Needs testing and maths :)
So there are many ways to accomplish proof of storage, we'd need just to figure out the which is the best.
Sidenote, this same algo could potentially be used with different settings for immutable, forever storage of data. Since there is no continuing cost to store data, TX Fee for every message (data) byte should be very high in such a coin.
Supply. Needs to be predictable and easy to understand. It would be preferential the standard mailing out is always 1x MailCoin, albeit coin itself should be practically infinitively divisable, and as such supply needs to be in the trillions eventually. But these things get complicated really fast, so we need to set a schedule.
Current email use is very large, so we should have something in the same magnitude. 8640 blocks per day - so maybe 10 000 coins per block == 86 400 000 new coins per day == 31 536 000 000 new coins per year, halving every 2 years. First halving: 63 072 000 000, Second halving: 94 608 000 000, Third (6 years): 110 376 000 000, but only halving 4 or 5 times to keep some new supply for ever increasing adoption and lost coins.
Got all the way here? :D
Thanks for reading up. Let me know what you think, and let's start a discussion on the feasibility of such a system!
I cannot develop this myself, but i would definitively back an effort up in the ways i can if anyone attempts to do something like this :) And i know i got probably many of the details incorrect
The main point of the methods described above is ease of adoption. Without adoption any system is worthless, and with email, you just cannot replace it like that (see the attempts trying to replace IPv4 with IPv6 ...), but you can enhance it. adoption is very critical in communications systems. (No one would have a phone if no one else had a phone)
Addendum 1: Forgot to add about pricing and markets, read comment here
Addendun 2: Bad actors and voting
submitted by PulsedMedia to Bitcoin [link] [comments]

IAMA 14 year old app dev. Introducing CryptoCalc 2 - please check it out.

tl:dr: CryptoCalc 2 is an uncomplicated, but powerful, CryptoCurrency ticker and converter, with a simple and intuitive interface, smart alerts, and more. Check the free version right here, or take a look at the 99 cent version here, or update either version for free if you already have it. They are the same, except for the free version having ads, and the free version does not have Smart Alerts.
Hello bitcoin! I am a 14 year old app developer, and a huge CryptoCurrency enthusiast. Today, I am announcing the newest version of my app, CryptoCalc, with smart price alerts, a new UI, more CryptoCurrencies, the same simplicity and ease of use as the original, and more.
I introduced CryptoCalc 1 a couple months ago, pitching it as a simple, but powerful app that you could use to check in on the bitcoin price and convert between fiat currency and bitcoin - free of the complexity and useless bells-and-whistles of other apps (After all, to just check on the bitcoin price, you shouldn’t have to swipe through hash rate, trade volume, and some meaningless graphs!). Many people liked it, but I also got some really great feedback.
That is why, today, I am introducing CryptoCalc 2, which builds on so much of the great feedback I have received. One feature I personally like a lot is Smart Alerts: useful, unobtrusive alerts and briefings on the bitcoin price - at launch time, we offer two types of smart alerts: Morning Briefing springs to life when you first unlock your phone in the morning, unobtrusively briefing you on the bitcoin price right on your lock screen. The app icon also updates throughout the day to keep you updated on the bitcoin price - all without compromising battery life. We are working on server-side logic for more alerts, such as price swings - your download will help us justify further improving the already useful Smart Alerts.
CryptoCalc’s new UI is clean and gorgeous - we have updated the look of the program to be even easier to use. Like the original, it shows you just what you need to know - the exchange rate - while facilitating easy conversions and calculations.
Support for bitcoin, but now bits, litecoin, dogecoin, and peercoin makes the app even more versatile than ever.
Thanks to translations purchased with the tips you guys have sent (again, thanks!), the app natively supports Portuguese, Spanish, French, Dutch, Greek, Finnish, Italian, German, Russian, Danish, Traditional Chinese, Simplified Chinese, and Hebrew!
And that’s just some of the new features… so, please check out CryptoCalc 2! You can find the free version here, or take a look at the 99 cent version here. They are the same, except for the free version having ads, and the free version does not have Smart Alerts. Or, if you have already downloaded it, just update for free.
Thanks - and as always, please feel free to give comments and feedback!
submitted by intergalacticrockets to CryptoCurrency [link] [comments]

IAMA 14 year old app developer. Please check out my new peercoin app.

tl:dr: CryptoCalc 2 is an uncomplicated, but powerful, peercoin ticker and converter, with a simple and intuitive interface, smart alerts, and more. Check the free version right here, or take a look at the 99 cent version here, or update either version for free if you already have it. They are the same, except for the free version having ads.
Hello peercoin! I am a 14 year old app developer, and a huge cryptocurrency enthusiast. Today, I am announcing the newest version of my app, CryptoCalc, with peercoin support, a new UI, more CryptoCurrencies, the same simplicity and ease of use as the original, and more.
I introduced CryptoCalc 1 a couple months ago here, pitching it as a simple, but powerful app that you could use to check in on the bitcoin price and convert between fiat currency and bitcoin - free of the complexity and useless bells-and-whistles of other apps (After all, to just check on the peercoin price, you shouldn’t have to swipe through hash rate, trade volume, and some meaningless graphs!). Many people liked it, but I also got some really great feedback.
That is why, today, I am introducing CryptoCalc 2, which builds on so much of the great feedback I have received. One idea someone suggested was to incorporate peercoin prices, which CryptoCalc 2 now supports.
CryptoCalc’s new UI is clean and gorgeous - we have updated the look of the program to be even easier to use. Like the original, it shows you just what you need to know - the exchange rate - while facilitating easy conversions and calculations.
Support for bitcoin, but now bits, litecoin, dogecoin, and peercoin makes the app even more versatile than ever.
The app natively supports Portuguese, Spanish, French, Dutch, Greek, Finnish, Italian, German, Russian, Danish, Traditional Chinese, Simplified Chinese, and Hebrew!
And that’s just some of the new features… so, please check out CryptoCalc 2! You can find the free version here, or take a look at the 99 cent version here. They are the same, except for the free version having ads, and the free version does not have Smart Alerts. Or, if you have already downloaded it, just update for free.
Thanks - and as always, please feel free to give comments and feedback!
submitted by intergalacticrockets to peercoin [link] [comments]

Need some external perspective on my latest project

A while back I found the calculator app I've been looking for, it's called Soulver, you can see a screencast that gives a good idea of how it works.
After a while with Soulver I realized that the concept could be taken quite a bit further. I decided to create something like Soulver, but web-based and much more powerful.
I've been working on it for a few weeks now and while there is still quite a bit to do (including quite a bit of css styling, it is very bare-bones right now). It's called "LastCalc" and you can see some examples of its usage here and play around with it:
http://lastcalc.com/BZn6kSqr
Currently it has the following capabilities:
Over the next week or two I will add the following capabilities:
Note that this last one, when combined with user-defined functions opens up incredible possibilities for extensibility, basically LastCalc can become a programmatic front-end to the Internet.
My problem is that most of the people I've asked to look at it so far don't seem to know what to make of it! I'm hoping for some feedback from some people that haven't been staring at this thing for two weeks :-)
Oh, and if you'd like to follow my progress with LastCalc you can follow it's Twitter account here.
submitted by sanity to webdesign [link] [comments]

Bitcoin Calculator - Cryptocurrency Converter for Android Bitcoin calculator - Convert BTC to USD, EUR, GPB and more ... How to Compound Bitcoin daily  Make Money Online ... Bitcoin Calculator Trading Online CryptoCurrency Calculator with multi-Cryptocurrencies Simple Bitcoin Converter

Each bitcoin (1 BTC) can have a fractional part of up to 8 digits so 1 bitcoin can be divided into 100 000 000 units. Each of these bitcoin units (0.00000001 BTC) is called a satoshi. A satoshi is the smallest unit in a bitcoin. This unit is named after Satoshi Nakamoto – the alias of the bitcoin creator. There are also intermediate measurement units (microbitcoins, millibitcoins, bitcents ... Online cryptocurrency wallet with multi-cryptocurrency accounts. Securely store, easily receive or send and quickly exchange your bitcoin, ethereum, litecoin and other cryptocurrencies. The exchange rate for the Bitcoin was last updated on October 24, 2020 from coinmarketcap.com. The exchange rate for the DogeCoin was last updated on October 24, 2020 from coinmarketcap.com. The BTC conversion factor has 15 significant digits. The XDG conversion factor has 12 significant digits. BTC XDG coinmill.com 0.00005 245 0.00010 490 0.00020 980 0.00050 2451 0.00100 4902 0.00200 9804 0 ... Bitcoin (BTC) United States Dollar "$" (USD) 1 Bitcoin (BTC) = United States Dollar "$" (USD) Refresh Save This Conversion. Popular Cryptocurrency Conversions. BTC to USD; BTC to AUD; BTC to BRL; BTC to CNY; BTC to GBP; BTC to INR; BTC to JPY; BTC to KRW; BTC to RUB; ETH to USD; ETH to AUD; ETH to BRL; ETH to CNY ; ETH to GBP; ETH to INR; ETH to JPY; ETH to KRW; ETH to RUB; XRP to USD; XRP to ... Find out the latest Bitcoin (BTC) value with cryptocurrency calculator. Convert Bitcoin and other cryptocurrency into any world currency including USD, GBP, EUR, CNY, JPY, and more

[index] [22352] [22390] [8019] [15477] [24620] [38338] [45821] [24940] [48973] [38581]

Bitcoin Calculator - Cryptocurrency Converter for Android

Convert Bitcoin and all Altcoin in US dollars. Cryptocurrency Converter and Calculator Tool CoinMarketCap Currency converter with live rates for all currencies. This Bitcoin calculator allows you to convert USD, EUR, CAD, GPB, AUD, RUB, BRL, INR, CNY, JPL to BTC. Easy to use.. See http://cryptosort.com/blog/bitcoin-c... How to Compound Bitcoin daily Make Money Online BITCOIN MINING (616) 432 - 7434 "PHRESH" ADD ME HERE https://www.facebook.com/profile.php?id=100011422870... Bitcoin Calculator Trading 10.000 Satoshis Bitcoin Address 1FTzjVtBeD7gZY7rdif5BtUdU2j54Z9sHQ [email protected] https://www.facebook.com/ariel.esae.9 https:... Google has partnered with Coinbase's API to add a Bitcoin price tracker and Bitcoin-to-fiat currency conversion calculator on its search engine. The tool also works in Google web search and mobile ...

#